Primary Antibodies

View as table Download

Rabbit monoclonal anti-OFLM4 antibody for SISCAPA, clone OTIR2A11

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated

OLFM4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen OLFM4 / Olfactomedin 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Orangutan, Rat, Hamster, Dog, Rabbit (88%); Galago, Mouse, Panda, Horse (81%).

OLFM4 Rabbit Polyclonal (aa400-450) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen OLFM4 / Olfactomedin 4 antibody was raised against a synthetic peptide corresponding to amino acids 400-419 (YVYNDGYLLNYDLSVLQKPQ) of human OLFM4 was used as immunogen for this antibody. Percent identity by BLAST analysis: Human, Gibbon (100%); Gorilla, Marmoset (95%); Monkey, Mouse, Rat (85%).

Rabbit Polyclonal OLFM4 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids between 400 and 450 of human OLFM4 was used as immunogen for this antibody.

OLFM4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan
Immunogen OLFM4 / Olfactomedin 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Galago, Marmoset (94%); Panda, Dog, Rabbit, Opossum (88%); Mouse, Rat, Horse (81%).

OLFM4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Dog, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen OLFM4 / Olfactomedin 4 antibody was raised against synthetic 15 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Dog (100%); Gibbon, Monkey, Panda (93%); Marmoset, Bat (87%); Hamster, Rabbit, Pig (80%).

Rabbit Polyclonal Anti-OLFM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OLFM4 antibody: synthetic peptide directed towards the C terminal of human OLFM4. Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Rabbit Polyclonal Anti-OLFM4 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLFM4

OLFM4 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLFM4

OLFM4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-510 of human OLFM4 (NP_006409.3).
Modifications Unmodified