Primary Antibodies

View as table Download

Rabbit anti-PRKRA Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKRA

Rabbit Polyclonal Anti-PRKRA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the middle region of human PRKRA. Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA

PRKRA mouse monoclonal antibody, clone 1B9-1A7, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

Rabbit Polyclonal Anti-PRKRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the N terminal of human PRKRA. Synthetic peptide located within the following region: MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP

PRKRA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PRKRA

PRKRA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PRKRA