Primary Antibodies

View as table Download

PYY rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PYY

Rabbit Polyclonal Anti-PYY Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PYY

Rabbit polyclonal anti canine / mouse / porcine / rat Peptide YY

Applications ELISA
Reactivities Canine, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala- Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn- Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Peptide YY (hu); neat antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala- Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu- Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein.

Pyy (3-36) mouse monoclonal antibody, clone RPY-B12, Aff - Purified

Applications ELISA, IF
Reactivities Rat

Rabbit Polyclonal Anti-PYY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYY antibody: synthetic peptide directed towards the middle region of human PYY. Synthetic peptide located within the following region: APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED

Rabbit polyclonal anti human Peptide YY

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala- Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu- Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Peptide YY (ca, ms, po, rt); diluted antiserum

Applications ELISA
Reactivities Canine, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala- Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn- Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein.

Rabbit polyclonal anti canine / mouse / porcine /rat Peptide YY

Applications ELISA
Reactivities Canine, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro- Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val- Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein.

Rabbit polyclonal anti Peptide YY (hu); purified rabbit IgG

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala- Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu- Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein.

Rabbit Polyclonal Anti-PYY Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PYY

PYY rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PYY