Peptide YY (PYY) Rabbit Polyclonal Antibody

CAT#: TA339396

Rabbit Polyclonal Anti-PYY Antibody

Product Images

WB Suggested Anti-PYY Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PYY antibody: synthetic peptide directed towards the middle region of human PYY. Synthetic peptide located within the following region: APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: peptide YY
• Database Link:
  NP_004151
  Entrez Gene 5697 Human
  UniProt ID P10082
• Background: The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity. [provided by RefSeq, Jul 2010]
• Synonyms: PYY-I; PYY1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 82%

Reference Data

• Protein Families: Secreted Protein, Transmembrane