Primary Antibodies

View as table Download

Rabbit polyclonal antibody to SSRP1 (structure specific recognition protein 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 75 and 338 of SSRP1 (Uniprot ID#Q08945)

Rabbit Polyclonal SSRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSRP1 antibody: human SSRP1 (Structure-specific recognition protein 1), the GST tagged N-terminal part of the protein.

Mouse Monoclonal anti-SSRP1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

SSRP1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 489-518 amino acids from the C-terminal region of Human SSRP1.

Mouse Monoclonal anti-SSRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-SSRP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the middle region of human SSRP1. Synthetic peptide located within the following region: SSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMS

Rabbit Polyclonal Anti-SSRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the middle region of human SSRP1. Synthetic peptide located within the following region: MKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESF

Rabbit Polyclonal Anti-SSRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the N terminal of human SSRP1. Synthetic peptide located within the following region: MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTE

SSRP1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SSRP1 (NP_003137.1).
Modifications Unmodified

SSRP1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SSRP1 (NP_003137.1).
Modifications Unmodified