Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SURF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SURF4 antibody: synthetic peptide directed towards the N terminal of human SURF4. Synthetic peptide located within the following region: GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ

SURF4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Chicken, Xenopus, Gorilla, Human, Mouse, Orang-Utan, Rat
Conjugation Unconjugated
Immunogen SURF4 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Turkey, Chicken, Xenopus, Salmon (100%); Marmoset, Hamster, Elephant, Panda, Dog, Bat, Opossum, Platypus, Pufferfish, Zebrafish (94%); Stickleback (89%).

SURF4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Orang-Utan
Immunogen SURF4 antibody was raised against synthetic 14 amino acid peptide from N-Terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Marmoset, Bovine (100%); Monkey, Mouse, Rat, Hamster, Elephant, Horse, Opossum, Turkey, Chicken, Platypus (93%); Panda, Dog, Xenopus (86%).

SURF4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bovine, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Gibbon
Conjugation Unconjugated
Immunogen SURF4 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine (100%); Opossum (93%); Turkey, Chicken, Xenopus (87%); Salmon, Stickleback (80%).

SURF4 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SURF4 (NP_001267719.1).