SURF4 Rabbit Polyclonal Antibody

CAT#: TA342052

Rabbit Polyclonal Anti-SURF4 Antibody

Product Images

WB Suggested Anti-SURF4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SURF4 antibody: synthetic peptide directed towards the N terminal of human SURF4. Synthetic peptide located within the following region: GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: surfeit 4
• Database Link:
  NP_149351
  Entrez Gene 6836 Human
  UniProt ID O15260
• Background: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport betweenThe endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs).The specific function ofThis protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.This gene is located inThe surfeit gene cluster, which is comprised of very tightly linked housekeeping genes that do not share sequence similarity.The encoded protein is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport betweenThe endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs).The specific function ofThis protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.This gene uses multiple polyadenylation sites, resulting in transcript length variation.The existence of alternatively spliced transcript variants has been suggested, butTheir validity has not been determined.
• Synonyms: ERV29
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane