Antibodies

Jump to Filters
View as table Download
BRCA1 Rabbit Polyclonal Antibody
TA310042

USD 465.00

In Stock

Rabbit anti-BRCA1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).
BRCA1 Rabbit Polyclonal Antibody
TA349262

USD 380.00

In Stock

Rabbit Polyclonal Anti-BRCA1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human BRCA1
PML Protein (PML) Rabbit Polyclonal Antibody
TA314354

USD 345.00

In Stock

Rabbit polyclonal anti-PML antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PML.
KEAP1 Rabbit Polyclonal Antibody
TA590238

USD 409.00

In Stock

Rabbit Polyclonal KEAP1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
MDM2 Rabbit Polyclonal Antibody
TA302211

USD 450.00

In Stock

Rabbit Polyclonal Antibody against MDM2 (C-term)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2.
MDM2 Rabbit Polyclonal Antibody
TA311995

USD 345.00

In Stock

Rabbit polyclonal anti-MDM2 antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MDM2.
PIAS3 Rabbit Polyclonal Antibody
TA319815

USD 430.00

In Stock

Rabbit Polyclonal PIAS3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS3 antibody was raised against a 12 amino acid synthetic peptide near the carboxy terminus of human PIAS3.
TRIM32 Rabbit Polyclonal Antibody
TA323256

USD 345.00

In Stock

Anti-TRIM32 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human tripartite motif containing 32
PIAS1 Rabbit Polyclonal Antibody
TA326261

USD 345.00

In Stock

Rabbit polyclonal PIAS1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS1.
PIAS3 Rabbit Polyclonal Antibody
TA326269

USD 345.00

In Stock

Rabbit polyclonal PIAS3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS3.
TRIM32 Rabbit Polyclonal Antibody
TA329387

USD 375.00

In Stock

Rabbit Polyclonal anti-TRIM32 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE
ITCH Rabbit Polyclonal Antibody
TA312425

USD 345.00

In Stock

Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N).
Modifications Phospho-specific
BRCA1 Rabbit Polyclonal Antibody
TA313518

USD 345.00

In Stock

Rabbit polyclonal BRCA1 (Ab-1423) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).
Von Hippel Lindau (VHL) Rabbit Polyclonal Antibody
TA321160

USD 345.00

In Stock

Anti-VHL Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TRIM32 Rabbit Polyclonal Antibody
TA323257

USD 345.00

In Stock

Anti-TRIM32 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human tripartite motif containing 32
ELOC Rabbit Polyclonal Antibody
TA350487

USD 345.00

In Stock

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
KEAP1 Rabbit Polyclonal Antibody
TA350545

USD 345.00

In Stock

Rabbit Polyclonal Anti-KEAP1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KEAP1
MDM2 Rabbit Polyclonal Antibody
TA350708

USD 345.00

In Stock

Rabbit Polyclonal Anti-MDM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MDM2
SMURF 2 (SMURF2) Rabbit Polyclonal Antibody
TA350762

USD 345.00

In Stock

Rabbit Polyclonal Anti-SMURF2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMURF2
PIAS1 Rabbit Polyclonal Antibody
TA350894

USD 345.00

In Stock

Rabbit Polyclonal Anti-PIAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS1
PIAS2 Rabbit Polyclonal Antibody
TA350895

USD 345.00

In Stock

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS2