B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Anti-CHRM2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 208-388 amino acids of human cholinergic receptor, muscarinic 2 |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with a sequence GSETPGKGGGSSSSSERSQP GAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSS EGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDR AGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human m1.3rd intracellular loop. |
Rabbit Polyclonal Anti-M2 Muscarinic Receptor
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with a sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid.� residues 225-356 of human m2. 3rd intracellular loo |
Rabbit Polyclonal Anti-CHRM5 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHRM5 / M5 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CHRM5. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Chimpanzee, Marmoset (88%); Dog, Bovine, Panda, Horse (81%). |
Rabbit Polyclonal Anti-CHRM2 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CHRM2 / M2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CHRM2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Marmoset, Sheep, Bovine, Elephant, Panda, Rabbit, Platypus (100%); Mouse, Rat, Bat, Dog, Hamster, Horse, Pig, Opossum, Guinea pig (95%); Turkey, Chicken (80%). |
Rabbit Polyclonal Anti-F2R Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | F2R / Thrombin Receptor / PAR1 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human Thrombin Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon, Baboon, Monkey (100%); Gorilla (95%). |
Anti-F2R Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
USD 345.00
In Stock
Germany
Japan
United Kingdom
China
