Antibodies

View as table Download

Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Semaphorin 3B (SEMA3B) (100-200) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Angiopoietin 1 (ANGPT1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Canine, Human, Rabbit, Rat
Conjugation Unconjugated

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.