Antibodies

Jump to Filters
View as table Download
Squalene Epoxidase (SQLE) Rabbit Polyclonal Antibody
TA346342

USD 475.00

5 Days

Rabbit Polyclonal Anti-SQLE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
DHCR7 Rabbit Polyclonal Antibody
TA349889

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DHCR7
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA350394

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DHCR24
C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody
TA351165

USD 345.00

In Stock

Rabbit Polyclonal Anti-MSMO1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MSMO1
TM7SF2 Rabbit Polyclonal Antibody
TA351818

USD 345.00

In Stock

Rabbit Polyclonal Anti-TM7SF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TM7SF2