Antibodies

View as table Download

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G).
Modifications Phospho-specific

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK

Rabbit Polyclonal CNOT4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Xenopus
Conjugation Unconjugated
Immunogen A portion of amino acids 50-100 of human CNOT4 was used as the immunogen for the antibody.

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ENO1