Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody

CAT#: TA335866

Rabbit Polyclonal Anti-ENO1 Antibody

Product Images

WB Suggested Anti-ENO1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate. ENO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-ENO1 Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: enolase 1
• Database Link:
  NP_001419
  Entrez Gene 24333 RatEntrez Gene 2023 Human
  UniProt ID P06733
• Background: ENO1 is one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.
• Synonyms: ENO1L1; MPB1; NNE; PPH
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Yeast: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation