Antibodies

Jump to Filters
View as table Download
Macrophage Scavenger Receptor I (MSR1) (300-400) Rabbit Polyclonal Antibody
RA25074-100

USD 360.00

2 Weeks

Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody
TA341643

USD 310.00

5 Days

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
EDG8 (S1PR5) Rabbit Polyclonal Antibody
TA337040

USD 424.00

5 Days

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.