Antibodies

View as table Download

Rabbit Monoclonal Antibody against MUC1 (Clone EP1024Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal CD227/MUC1 (Tyr1229) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CD227/MUC1 around the phosphorylation site of tyrosine 1229 (S-P-YP-E-K)
Modifications Phospho-specific

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit polyclonal CD227/MUC1 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CD227/MUC1.

Rabbit Polyclonal Anti-MUC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1

Rabbit Polyclonal Anti-MUC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1

Rabbit Polyclonal Anti-MUC1(NT) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1(NT)

Rabbit Polyclonal Anti-MUC1(CT) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1(CT)