Antibodies

Jump to Filters
View as table Download
P2X2 (P2RX2) Rabbit Polyclonal Antibody
RA10108-150

USD 350.00

2 Weeks

P2X2 (P2RX2) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat
Conjugation Unconjugated
P2X2 (P2RX2) Rabbit Polyclonal Antibody
TA338577

USD 310.00

5 Days

Rabbit Polyclonal Anti-P2RX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the middle region of human P2RX2. Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK
P2X2 (P2RX2) Rabbit Polyclonal Antibody
TA351479

USD 345.00

In Stock

Rabbit Polyclonal Anti-P2RX2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human P2RX2