P2X2 (P2RX2) Rabbit Polyclonal Antibody

CAT#: TA338577

Rabbit Polyclonal Anti-P2RX2 Antibody

Product Images

WB Suggested Anti-P2RX2 Antibody Titration: 0.6 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the middle region of human P2RX2. Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: purinergic receptor P2X 2
• Database Link:
  NP_777361
  Entrez Gene 22953 Human
  UniProt ID Q9UBL9
• Background: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013]
• Synonyms: DFNA41; P2X2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 91%; Mouse: 91%; Pig: 85%; Rabbit: 85%; Guinea pig: 85%; Dog: 77%; Horse: 77%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: ATP Receptors, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction