Germany
Japan
United Kingdom
China
P2RX2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human P2RX2 |
Antibodies
View as table Download
Rabbit polyclonal Anti-P2X2 Receptor (extracellular)
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KSDYLKHSTFDQDS, corresponding to amino acid residues 207-220 of rat P2X2 with replacement of cysteine 214 (C214) with serine (*S) . Extracellular. |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the middle region of human P2RX2. Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFH |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: YFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEG |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: VRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFH |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the middle region of human P2RX2. Synthetic peptide located within the following region: IRIDVIVHGQAGKFSLIPTIINLATALTSVGVVRNPLWGPSGCGGSTRPL |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human P2RX2 |
P2rx2 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
P2RX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-320 of human P2RX2 (NP_733782.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- P2RX2