P2X2 (P2RX2) Rabbit Polyclonal Antibody
Other products for "P2RX2"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFH |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 44 kDa |
| Gene Name | purinergic receptor P2X 2 |
| Database Link | |
| Background | The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013] |
| Synonyms | DFNA41; P2X2 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 90%; Pig: 83%; Guinea pig: 83%; Rabbit: 79%; Bovine: 75% |
| Reference Data | |
| Protein Families | Druggable Genome, Ion Channels: ATP Receptors, Transmembrane |
| Protein Pathways | Calcium signaling pathway, Neuroactive ligand-receptor interaction |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China