Antibodies

Jump to Filters
View as table Download
SPTLC1 Rabbit Polyclonal Antibody
AP05280PU-N

USD 360.00

5 Days

SPTLC1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide derived from the Human Sserine Palmitoyltransferase enzyme
SPTLC1 Rabbit Polyclonal Antibody
TA319826

USD 430.00

5 Days

Rabbit Polyclonal SPT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen SPT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SPT1. The immunogen is located within amino acids 380 - 430 of SPT1.
SPTLC1 Rabbit Polyclonal Antibody
TA339044

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPTLC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI
SPTLC1 Rabbit Polyclonal Antibody
TA349565

USD 345.00

In Stock

Rabbit Polyclonal Anti-SPTLC1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SPTLC1