Antibodies

Jump to Filters
View as table Download
ERCC8 (106-300) Rabbit Polyclonal Antibody
AP23086PU-N

USD 440.00

2 Weeks

ERCC8 (106-300) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Recombinant protein fragment corresponding to a region within amino acids 106 and 300 of CSA
ERCC8 (Center) Rabbit Polyclonal Antibody
AP51450PU-N

USD 450.00

2 Weeks

ERCC8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 210-238 amino acids from the Central region of Human ERCC8
ERCC8 Rabbit Polyclonal Antibody
TA329326

USD 375.00

5 Days

Rabbit Polyclonal anti-ERCC8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG