Antibodies

Jump to Filters
View as table Download
KCNN2 Rabbit Polyclonal Antibody
TA372846

USD 380.00

4 Weeks

KCNN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNN2
Kcnn2 Rabbit Polyclonal Antibody
TA328940

USD 585.00

3 Weeks

Rabbit polyclonal Anti-KCa2.2 (SK2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)ETQMENYDKHVTYNAERS, corresponding to amino acid residues 542-559 of rat KCa2.2. Intracellular, C-terminal part.
KCNN2 Rabbit Polyclonal Antibody
TA338526

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
KCNN2 Rabbit Polyclonal Antibody
TA316947

USD 425.00

5 Days

KCNN2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Immunogen KCNN2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human KCNN2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Hamster, Panda, Dog, Horse, Guinea pig (94%); Marmoset, Rat, Elephant, Bat (89%); Mouse, Pig (83%).
KCNN2 Rabbit Polyclonal Antibody
TA368610

USD 380.00

4 Weeks

KCNN2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNN2