Antibodies

Jump to Filters
View as table Download
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA371961

USD 380.00

4 Weeks

TYRP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TYRP1
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335249

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
TRP1 (TYRP1) Rabbit Monoclonal Antibody [Clone ID: TA99]
TA385802

USD 523.00

2 Weeks

Recombinant Anti-TRP-1, gp75 (Clone TA99)

Applications ELISA, FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.