Antibodies

Jump to Filters
View as table Download
AMID (AIFM2) Rabbit Polyclonal Antibody
TA372285

USD 380.00

4 Weeks

AIFM2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AIFM2
AMID (AIFM2) (C-term) Rabbit Polyclonal Antibody
AP50123PU-N

USD 450.00

2 Weeks

AMID (AIFM2) (C-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 326~356 amino acids from the C-terminal region of human AIFM2
AMID (AIFM2) Rabbit Polyclonal Antibody
TA330412

USD 375.00

5 Days

Rabbit Polyclonal Anti-AIFM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
AIFM2 Rabbit Polyclonal Antibody
TA366890

USD 380.00

4 Weeks

AIFM2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AIFM2
AIFM2 Rabbit Polyclonal Antibody
TA368047

USD 380.00

4 Weeks

AIFM2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AIFM2
AMID (AIFM2) Rabbit Polyclonal Antibody
TA383688

USD 380.00

4 Weeks

FSP1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human AMID. at AA rangle: 110-190