AIFM2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AIFM2 |
AIFM2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AIFM2 |
AMID (AIFM2) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 326~356 amino acids from the C-terminal region of human AIFM2 |
Rabbit Polyclonal Anti-AIFM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP |
AIFM2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AIFM2 |
AIFM2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AIFM2 |
FSP1 Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from the Internal region of human AMID. at AA rangle: 110-190 |