Antibodies

View as table Download

Rabbit Polyclonal Anti-ARC Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARC

Rabbit Polyclonal Anti-ARC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARC antibody: synthetic peptide directed towards the middle region of human ARC. Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF

ARC rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ARC