Arg 3.1 (ARC) Rabbit Polyclonal Antibody

CAT#: TA341641

Rabbit Polyclonal Anti-ARC Antibody

Product Images

WB Suggested Anti-ARC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: ARC; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ARC; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ARC; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml

• 

  Immunohistochemistry with Adrenal tissue at an antibody concentration of 5 ug/ml using anti-ARC antibody

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARC antibody: synthetic peptide directed towards the middle region of human ARC. Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: activity-regulated cytoskeleton-associated protein
• Database Link:
  NP_056008
  Entrez Gene 23237 Human
  UniProt ID Q7LC44
• Background: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity.The protein is also required for homeostatic synaptic scaling of AMPA receptors.
• Synonyms: Arg3.1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%