Antibodies

Jump to Filters
View as table Download
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA301430

USD 479.00

5 Days

Rabbit Polyclonal Antibody against MOP3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human MOP3 (C-terminus).
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA329741

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA383749

USD 380.00

4 Weeks

BMAL1 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human BMAL1 around the non-acetylation site of Lys538. AA range:501-550