Antibodies

Jump to Filters
View as table Download
c-Myb (MYB) Rabbit Polyclonal Antibody
AP21138PU-N

USD 370.00

2 Weeks

c-Myb (MYB) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 491-540 of Human c-Myb.
c-Myb (MYB) (N-term) Rabbit Polyclonal Antibody
AP31223PU-N

USD 440.00

2 Weeks

c-Myb (MYB) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide from human MYB (aa1-50). 
aa1-50
c-Myb (MYB) Rabbit Polyclonal Antibody
TA326051

USD 345.00

In Stock

Rabbit polyclonal Myb (Phospho-Ser532) antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T).
Modifications Phospho-specific
c-Myb (MYB) Rabbit Polyclonal Antibody
TA343534

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYB antibody: synthetic peptide directed towards the N terminal of human MYB. Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD
c-Myb (MYB) Rabbit Polyclonal Antibody
TA350998

USD 345.00

In Stock

Rabbit Polyclonal Anti-MYB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MYB
c-Myb (MYB) Rabbit Polyclonal Antibody
TA384821

USD 380.00

4 Weeks

Phospho-c Myb (Ser11) Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Myb (Phosphorylated)