Antibodies

Jump to Filters
View as table Download
PABP (PABPC1) Rabbit Polyclonal Antibody
TA345803

USD 475.00

5 Days

Rabbit Polyclonal Anti-PABPC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PABPC1 antibody: synthetic peptide directed towards the middle region of human PABPC1. Synthetic peptide located within the following region: LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
PABP (PABPC1) Rabbit Polyclonal Antibody
TA379564

USD 220.00

3 Weeks

polyclonal AntibodyPC1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC1 (NP_002559.2).
Modifications Unmodified