Antibodies

View as table Download

Rabbit anti-SMARCE1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SMARCE1

Rabbit Polyclonal Anti-SMARCE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMARCE1 Antibody: synthetic peptide directed towards the N terminal of human SMARCE1. Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR

BAF57/SMARCE1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-411 of human BAF57/BAF57/SMARCE1 (NP_003070.3).
Modifications Unmodified