SMARCE1 Rabbit Polyclonal Antibody

CAT#: TA335790

Rabbit Polyclonal Anti-SMARCE1 Antibody

Product Images

Lanes: Lane 1: HeLa (human)Lane 2: NHEM (human)Lane 3: Melba (mouse)Lane 4: NIH3T3 (mouse)Lane 5: S16 (rat)Lane 6: H9C2 (rat); Primary Antibody Dilution: 1: 500; Secondary Antibody: Donkey anti-rabbit-HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: SMARCE1; Submitted by: Ivana de la Serna, University of Toledo

• 

  WB Suggested Anti-SMARCE1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate. SMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human kidney

• 

  Rabbit Anti-SMARCE1 antibody; Paraffin Embedded Tissue: Human Lung; cell Cellular Data: alveolar cell; Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SMARCE1 Antibody: synthetic peptide directed towards the N terminal of human SMARCE1. Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
• Database Link:
  NP_003070
  Entrez Gene 57376 MouseEntrez Gene 303518 RatEntrez Gene 6605 Human
  UniProt ID Q969G3
• Background: SMARCE1 is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.
• Synonyms: BAF57; CSS5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors