Antibodies

Jump to Filters
View as table Download
TRIB1 Rabbit Polyclonal Antibody
TA340200

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
TRIB1 Rabbit Polyclonal Antibody
TA351856

USD 345.00

In Stock

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRIB1
TRIB1 Rabbit Polyclonal Antibody
TA367330

USD 380.00

4 Weeks

TRIB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRIB1