TRIB1 Rabbit Polyclonal Antibody

CAT#: TA340200

Rabbit Polyclonal Anti-TRIB1 Antibody

Product Images

WB Suggested Anti-TRIB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Intestine

• 

  Host: Rabbit; Target Name: TRIB1; Sample Tissue: COLO205; Antibody Dilution: 1.0 ug/ml; TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205

• 

  Rabbit Anti-TRIB1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in alveolar type I & II cells; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Co

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: tribbles pseudokinase 1
• Database Link:
  NP_079471
  Entrez Gene 10221 Human
  UniProt ID Q96RU8
• Background: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.
• Synonyms: C8FW; GIG-2; GIG2; SKIP1; TRB-1; TRB1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase