Antibodies

Jump to Filters
View as table Download
Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody
TA326897

USD 374.00

In Stock

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1
MTREX Rabbit Polyclonal Antibody
TA332776

USD 275.00

2 Weeks

Rabbit anti-MTR4 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MTR4
LSM4 Rabbit Polyclonal Antibody
TA332973

USD 275.00

3 Weeks

Rabbit anti-LSM4 Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LSM4
Grp75 (HSPA9) Rabbit Polyclonal Antibody
TA329128

USD 375.00

5 Days

Rabbit Polyclonal anti-HSPA9 antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ