Grp75 (HSPA9) Rabbit Polyclonal Antibody

CAT#: TA329128

Rabbit Polyclonal anti-HSPA9 antibody

Product Images

Sample Type: rat brain extract (80ug); Primary antibody dilution: 2ug/ml; Secondary antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary antibody dilution: 1: 20,000; Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science

• 

  WB Suggested Anti-HSPA9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysateHSPA9 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

• 

  Sample Type : Human brain stem cellsPrimary Antibody Dilution : 1:500Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution : 1:1000Color/Signal Descriptions : HSPA9: Red DAPI:BlueGene Name : HSPA9Submitted by : Dr. Yuzhi Chen, University of Arkansas for Medical Science

• 

  Sample Type : Human brain stem cellsPrimary Antibody Dilution : 1:500Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution : 1:1000Color/Signal Descriptions : HSPA9: Red DAPI:BlueGene Name : HSPA9Submitted by : Dr. Yuzhi Chen, University of Arkansas for Medical Science

• 

  Skeletal muscle

• 

  Data Provided by Dr. Yuzhi Chen, University of Arkansas for Medical SciencesNT2 cells were pretreated with 2N HCL for 30 minutesWashed 3x in PBSStained for 2 hours with 1ug/50ul antibodyand Incubated in Alexa goat-rabbit 594 for 1H.Images were obtained with a 40x objectiveNT-2 cellsAntibody: RedDAPI: Blue

• Amount and Sample Type : 500 ug mouse brain homogenate; Amount of IP Antibody : 6 ug; Primary Antibody : HSPA9; Primary Antibody Dilution : 1:500; Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution : 1:5000; Gene Name : HSPA9; Submitted by : Dr. Yuzhi Chen, University of Arkansas for Medical Science

Show all 7 images

Specifications

Product Data

• Applications: IHC, IP, WB
• Recommended Dilution: WB, IHC, IP
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: heat shock protein family A (Hsp70) member 9
• Database Link:
  NP_004125
  Entrez Gene 15526 MouseEntrez Gene 291671 RatEntrez Gene 3313 Human
  UniProt ID P38646
• Background: HSPA9 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA9 is a heat-shock cognate protein. This protein plays a role in the control of cell proliferation. It may also act as a chaperone.CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein plays a role in the control of cell proliferation. It may also act as a chaperone. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase and contains a Sac domain. The activity of this protein is specific for phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate. Alternatively spliced transcript variants have been observed, but most of them are not thought to be protein-coding.
• Synonyms: CSA; GRP-75; GRP75; HEL-S-124m; HSPA9B; MOT; MOT2; MTHSP75; PBP74
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Guinea pig: 92%; Bovine: 85%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation