Antibodies

Jump to Filters
View as table Download
NSE (ENO2) Rabbit Polyclonal Antibody
TA309202

USD 365.00

In Stock

Rabbit Anti-NSE (Neuron specific enolase) Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant human NSE expressed in and purified from E. coli
Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody
TA326897

USD 374.00

In Stock

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1
RQCD1 (CNOT9) Rabbit Polyclonal Antibody
TA331222

USD 375.00

In Stock

Rabbit Polyclonal Anti-RQCD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK
PNPT1 Rabbit Polyclonal Antibody
TA308057

USD 415.00

In Stock

Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8)
NSE (ENO2) Rabbit Polyclonal Antibody
TA311937

USD 345.00

In Stock

Rabbit polyclonal anti-NSE / ENO2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NSE.
Hsp60 (HSPD1) Rabbit Polyclonal Antibody
TA311958

USD 345.00

In Stock

Rabbit polyclonal anti-HSP60 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP60.
Hsp60 (HSPD1) Rabbit Polyclonal Antibody
TA324748

USD 450.00

In Stock

Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1.
NSE (ENO2) Rabbit Polyclonal Antibody
TA590105

USD 409.00

In Stock

Rabbit Polyclonal NSE Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
CNOT2 Rabbit Polyclonal Antibody
TA314275

USD 345.00

In Stock

Rabbit polyclonal CNOT2 (Ab-101) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G).
CNOT7 Rabbit Polyclonal Antibody
TA315399

USD 345.00

In Stock

Rabbit polyclonal anti-CNOT7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CNOT7.
DCP1A Rabbit Polyclonal Antibody
TA326292

USD 345.00

In Stock

Rabbit polyclonal DCP1A antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCP1A.
NSE (ENO2) Rabbit Polyclonal Antibody
TA321414

USD 345.00

In Stock

Anti-ENO2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of Human enolase 2 (gamma, neuronal)
Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody
TA349722

USD 345.00

In Stock

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ENO1
Grp75 (HSPA9) Rabbit Polyclonal Antibody
TA350037

USD 345.00

In Stock

Rabbit Polyclonal Anti-HSPA9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA9