Antibodies

View as table Download

Rabbit anti-FLI1 Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FLI1

Rabbit polyclonal anti-FLI1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human FLI1.

Rabbit Polyclonal Anti-FLI1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1. Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 Antibody: A synthesized peptide derived from human FLI1

Rabbit Polyclonal FLI1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FLI1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human FLI1. The immunogen is located within the last 50 amino acids of FLI1 .

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: TASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCS

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FLI1