FLI1 Rabbit Polyclonal Antibody

CAT#: TA330112

Rabbit Polyclonal Anti-FLI1 Antibody

Product Images

WB Suggested Anti-FLI1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateFLI1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-FLI1 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1. Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: Fli-1 proto-oncogene, ETS transcription factor
• Database Link:
  NP_002008
  Entrez Gene 2313 Human
  UniProt ID Q01543
• Background: Friend leukemia integration 1 (Fli-1) is a member of the ETS family of transcriptional regulatory proteins that contain a highly conserved and structurally unique DNA binding ETS domain.
• Synonyms: EWSR2; SIC-1
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 92%; African clawed frog: 85%; Horse: 85%

Reference Data

• Protein Families: Transcription Factors