Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1

Rabbit Polyclonal Antibody against PYGM (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PYGM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 698-727 amino acids from the C-terminal region of human PYGM.