Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Anti-SOX2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2 |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT2 |
Active filters
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Families
- Adult stem cells
Citations
- Yes
Filter by
Category
Target Symbol
Clonalities
Conjugates
Modifications
Pathways
- Hematopoietic cell lineage (3)
- MAPK signaling pathway (3)
- Pathways in cancer (3)
- Antigen processing and presentation (2)
- Basal cell carcinoma (2)
- Cell adhesion molecules (CAMs) (2)
- Dorso-ventral axis formation (2)
- Hedgehog signaling pathway (2)
- Huntington's disease (2)
- Neurotrophin signaling pathway (2)
- Primary immunodeficiency (2)
- T cell receptor signaling pathway (2)
- Adherens junction (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Colorectal cancer (1)
- Cytokine-cytokine receptor interaction (1)
- ECM-receptor interaction (1)
- Endocytosis (1)
- Endometrial cancer (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Focal adhesion (1)
- Gap junction (1)
- Glioma (1)
- GnRH signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Melanogenesis (1)
- Melanoma (1)
- Non-small cell lung cancer (1)
- Notch signaling pathway (1)
- Pancreatic cancer (1)
- Prion diseases (1)
- Prostate cancer (1)
- Regulation of actin cytoskeleton (1)
- Wnt signaling pathway (1)