Antibodies

Jump to Filters
View as table Download
XRCC2 Rabbit Polyclonal Antibody
TA327180

USD 275.00

2 Weeks

XRCC2 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC2
XRCC2 Rabbit Polyclonal Antibody
TA344287

USD 475.00

5 Days

Rabbit Polyclonal Anti-XRCC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XRCC2 antibody: synthetic peptide directed towards the middle region of human XRCC2. Synthetic peptide located within the following region: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
XRCC2 Rabbit Polyclonal Antibody
TA308789

USD 415.00

5 Days

Rabbit polyclonal antibody to XRCC2 (X-ray repair complementing defective repair in Chinese hamster cells 2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 123 of XRCC2 (Uniprot ID#O43543)