Antibodies

Jump to Filters
View as table Download
GGA2 Rabbit Polyclonal Antibody
TA326980

USD 275.00

3 Weeks

GGA2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GGA2
GGA2 Rabbit Polyclonal Antibody
TA322356

USD 345.00

4 Weeks

Anti-GGA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 300 amino acids of human golgi-associated, gamma adaptin ear containing, ARF binding protein 2
GGA2 Rabbit Polyclonal Antibody
TA343361

USD 375.00

5 Days

Rabbit Polyclonal Anti-GGA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GGA2 antibody is: synthetic peptide directed towards the N-terminal region of Human GGA2. Synthetic peptide located within the following region: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH