Antibodies

Jump to Filters
View as table Download
BDKRB1 Rabbit Polyclonal Antibody
TA311799

USD 345.00

In Stock

Rabbit polyclonal anti-BDKRB1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BDKRB1.
Modifications Phospho-specific
BDKRB1 Rabbit Polyclonal Antibody
TA338374

USD 375.00

5 Days

Rabbit Polyclonal Anti-BDKRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ
BDKRB1 (Center) Rabbit Polyclonal Antibody
AP17901PU-N

USD 450.00

2 Weeks

BDKRB1 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human BDKRB1
BDKRB1 Rabbit Polyclonal Antibody
TA358861

USD 360.00

5 Days

BDKRB1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated