Antibodies

Jump to Filters
View as table Download
ACSF2 Rabbit Polyclonal Antibody
TA343062

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACSF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSF2 antibody: synthetic peptide directed towards the C terminal of human ACSF2. Synthetic peptide located within the following region: DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL
ACSF2 Rabbit Polyclonal Antibody
TA365897

USD 380.00

4 Weeks

ACSF2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACSF2