Antibodies

Jump to Filters
View as table Download
APOBEC1 Rabbit Polyclonal Antibody
TA345784

USD 475.00

5 Days

Rabbit Polyclonal Anti-APOBEC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOBEC1 antibody: synthetic peptide directed towards the N terminal of human APOBEC1. Synthetic peptide located within the following region: TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW
APOBEC1 Rabbit Polyclonal Antibody
TA373588

USD 220.00

3 Weeks

APOBEC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP_001291495).