APOBEC1 Rabbit Polyclonal Antibody

CAT#: TA345784

Rabbit Polyclonal Anti-APOBEC1 Antibody

Product Images

WB Suggested Anti-APOBEC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APOBEC1 antibody: synthetic peptide directed towards the N terminal of human APOBEC1. Synthetic peptide located within the following region: TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: apolipoprotein B mRNA editing enzyme catalytic subunit 1
• Database Link:
  NP_001635
  Entrez Gene 339 Human
  UniProt ID P41238
• Background: APOBEC1 is a member of the cytidine deaminase enzyme family. The protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: APOBEC-1; BEDP; CDAR1; HEPR
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Mouse: 86%; Dog: 79%; Horse: 79%; Rabbit: 79%