Antibodies

View as table Download

Rabbit Polyclonal JMJD6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen JMJD6 antibody was raised against a 15 amino acid peptide from near the amino terminus of human JMJD6.

Rabbit anti-JMJD6 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human JMJD6

Rabbit Polyclonal Anti-JMJD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JMJD6 antibody: synthetic peptide directed towards the N terminal of human JMJD6. Synthetic peptide located within the following region: NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADA

Rabbit Polyclonal Anti-PTDSR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the C terminal of human PTDSR. Synthetic peptide located within the following region: VVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSD

Rabbit polyclonal antibody to PSR (jumonji domain containing 6)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of PSR (Uniprot ID#Q6NYC1)

Rabbit Polyclonal anti-PTDSR antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the middle region of human PTDSR. Synthetic peptide located within the following region: PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGE

Rabbit Polyclonal JMJD6/PSR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human JMJD6 protein (within residues 150-350). [Swiss-Prot Q6NYC1]

Rabbit Polyclonal Anti-JMJD6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human JMJD6