Rabbit Polyclonal SCF Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF. |
Rabbit Polyclonal SCF Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF. |
Rabbit Polyclonal Anti-KITLG Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG |