Antibodies

Jump to Filters
View as table Download
Cytochrome P450 2A6 (CYP2A6) Rabbit Polyclonal Antibody
TA332933

USD 275.00

3 Weeks

Rabbit anti-CYP2A6 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP2A6
Xanthine Oxidase (XDH) Rabbit Polyclonal Antibody
TA343291

USD 375.00

5 Days

Rabbit Polyclonal Anti-XDH Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS