Xanthine Oxidase (XDH) Rabbit Polyclonal Antibody

CAT#: TA343291

Rabbit Polyclonal Anti-XDH Antibody

Product Images

Host: Rabbit; Target Name: Xdh; Sample Tissue: Rat Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 146 kDa
• Gene Name: xanthine dehydrogenase
• Database Link:
  NP_000370
  Entrez Gene 497811 Rat
  UniProt ID P47989
• Background: Xdh catalyzes the conversion of xanthine + NAD+ + H2O to urate + NADH + H+; It may be involved in response to aluminium and aluminium toxicity.
• Synonyms: XAN1; XO; XOR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Caffeine metabolism, Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism